- Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00170/AtMg00620 (AtMg00170)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1000040
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,710 Da
- E Coli or Yeast
- 1-139
- Uncharacterized mitochondrial protein AtMg00170/AtMg00620 (AtMg00170)
- T18C6_30, T18C6.30
Sequence
MIQRTRNQSIMLSLPSNQSANHAILTFQPIGQSRYLLTFQPTPSIPLLQQYIISVPYLDAYSSICFPVMARIRSAKYCFFFFLVLFLNGIIATRGKAMLPTLPQKGAAFFPPKMPVPPSGPSKQHNSAPRSDFVQFFYM